SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000008979 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000008979
Domain Number 1 Region: 414-527,647-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.37e-68
Family Phosphate binding protein-like 0.000000159
Further Details:      
 
Domain Number 2 Region: 20-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-38
Family L-arabinose binding protein-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000008979   Gene: ENSDORG00000009556   Transcript: ENSDORT00000009556
Sequence length 954
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_82:20152:231787:-1 gene:ENSDORG00000009556 transcript:ENSDORT00000009556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHVSAPLVLLPAWFLMVSCSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFIKFQFQRFTTLNLHPSNTDISVAVAGVLNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDSRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFSQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWHGTSLMYLRMVELEGLTGH
IEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLRMDSHLYASNISDSLFNTTLVVTT
ILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTW
TGMVGELISRKADLAVAGLTITSEREKVIDFSKPFMTLGISILYRVHMGRRPGYFSFLDP
FSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVG
GFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQ
TAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLL
ESTMNEYYRQRNCNLTQIGDLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRK
WWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVC
QEMMAELRSIILCQDSVHPRRRRAGPARAGPPAPEERRPRGTATLSNGELCGAGAPDQLA
QRLAQEAALVARGCTHVRVCLECRRFQGLRARPFPARSDDSLDWDKTTTSSGPE
Download sequence
Identical sequences ENSDORP00000008979 ENSDORP00000008979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]