SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009148 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009148
Domain Number 1 Region: 2-348
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.23e-73
Family ADP-ribosylglycohydrolase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009148   Gene: ENSDORG00000009733   Transcript: ENSDORT00000009732
Sequence length 357
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3636:3924:8352:1 gene:ENSDORG00000009733 transcript:ENSDORT00000009732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKYVAAMLLSAAGDALGYFNGKWEFLRSGEKIHQQLAQMGGLEAIDVELWRVSDDTVMH
LATAEALLEAGKAPSFDQLYSLLAKHYQDCMGDMDGRAPGGASMSNAMQLEPHKANGWRI
PFNKREGGCGAAMRAMCIGLRFPHRSQLDTLIRVSIESGRMTHHHPTGYLGALASALFTA
YAVNGKPPWQWGKGLMEVLPEAQKYIVQSGYFVEENLQHWSYFQDQWEKYLNLRGILDGK
SAPTSHQPFTVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFQGVSPSNYEKLEYRDRLEETARALHSLVSKEDTAMGL
Download sequence
Identical sequences ENSDORP00000009148 ENSDORP00000009148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]