SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009442 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009442
Domain Number 1 Region: 92-156
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000262
Family VWC domain 0.025
Further Details:      
 
Domain Number 2 Region: 309-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000434
Family EGF-type module 0.077
Further Details:      
 
Domain Number 3 Region: 453-518
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000774
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 344-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009442
Domain Number - Region: 148-220
Classification Level Classification E-value
Superfamily FnI-like domain 0.000115
Family VWC domain 0.091
Further Details:      
 
Domain Number - Region: 427-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000549
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009442   Gene: ENSDORG00000010044   Transcript: ENSDORT00000010044
Sequence length 640
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5999:7020:105452:-1 gene:ENSDORG00000010044 transcript:ENSDORT00000010044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPFPRNLPLGTTFWLGQRYNAHGYFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLSRAEQRMNRLDQCYCERTCTMKGTTYREFQSWTDGCKNCTC
LNGTIQCETLVCPAPDCPPKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVC
VLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHDECLTNQHSCDENALCFNTVGGHNCVCKPGYMGNGTICKAFCKDGCRNGGACI
AANVCACPQGFTGPSCETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXIDECGAGRHNCANDTVCFNLDGGYDCRCPHGKNCTGDCVHGGRVKHNGQIWVLE
NDRCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETVYNSGDTWL
QSCQQCRCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLDE
MNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences ENSDORP00000009442 ENSDORP00000009442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]