SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009522 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009522
Domain Number 1 Region: 1544-1718
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-27
Family Fibronectin type III 0.0000744
Further Details:      
 
Domain Number 2 Region: 1910-2077
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-27
Family Fibronectin type III 0.0000114
Further Details:      
 
Domain Number 3 Region: 914-1084
Classification Level Classification E-value
Superfamily Fibronectin type III 5.61e-26
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 732-897
Classification Level Classification E-value
Superfamily Fibronectin type III 4.1e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 5 Region: 1729-1900
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-21
Family Fibronectin type III 0.00094
Further Details:      
 
Domain Number 6 Region: 1269-1443
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-21
Family Fibronectin type III 0.0000114
Further Details:      
 
Domain Number 7 Region: 414-469
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-20
Family Fibronectin type II module 0.0000483
Further Details:      
 
Domain Number 8 Region: 354-408
Classification Level Classification E-value
Superfamily Kringle-like 1.97e-20
Family Fibronectin type II module 0.0000664
Further Details:      
 
Domain Number 9 Region: 1451-1541
Classification Level Classification E-value
Superfamily Fibronectin type III 8.39e-20
Family Fibronectin type III 0.00000719
Further Details:      
 
Domain Number 10 Region: 564-610
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000103
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 11 Region: 2345-2388
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 236-279
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000576
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 13 Region: 625-706
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000683
Family Fibronectin type III 0.00000519
Further Details:      
 
Domain Number 14 Region: 523-566
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000072
Family Fibronectin type I module 0.0048
Further Details:      
 
Domain Number 15 Region: 99-144
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000034
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 2300-2343
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000107
Family Fibronectin type I module 0.0033
Further Details:      
 
Domain Number 17 Region: 190-233
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000116
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 1098-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000205
Family Fibronectin type III 0.0000198
Further Details:      
 
Domain Number 19 Region: 55-96
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 20 Region: 147-187
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2388-2429
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 2214-2265
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000302
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009522   Gene: ENSDORG00000010128   Transcript: ENSDORT00000010130
Sequence length 2457
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3209:34382:106040:-1 gene:ENSDORG00000010128 transcript:ENSDORT00000010130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGPGPRLPPPPLLLLAAALCLGTVVPAVGASRSKRQAQQIVQPQSPVPVSQSKPGCYD
NGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPETEETCFDKYTGNTYRVGDTYER
PKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGK
GEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQ
DTRTSYRIGDTWSKKDNRGNMLQCVCTGNGRGEWKCERHASLQTTSSXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTQTYGGN
SNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGN
SNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDVDQKFGFCPMAAHEEICTTNE
GVMYRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQCIVDDITYNVNDTFHK
RHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRG
IGEWHCQPLQSYPGTSGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGR
WKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGQREVTRFDFTTSPSTPVTSNTVTGE
TAPFSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEKGGEPQYLDLPSTATS
VNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRP
QAPITGYRIVYSPSLEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFI
QQETTGVPRTDKVSPPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVLPVNLPGEHGQRL
PVSRNTFAEISGLTPGVTYYFKVFAVNQGRESKPLIAQQTTKLDPPTNLQFTNETDTTVM
VTWTPPRARIAGYRLTVGLTRGGQPKQYNVGPSASKYPLRNLQPGSEYTVSLVAVKSNQQ
SPKATGVFTTLQPVSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSE
TGSVMVSGLTPGVEYTYTVQVLRDGQERNIPPIVNTVVTPLSPPTNLHLETHPDTGVLVV
SWERSTTPDITGYRITTTPTDGQQGTSLEEVVHADQSCTLLNPGLEYNVSVYTVKDDKES
VPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFV
DSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGSDTMRV
TWAPPPSIELTNLLVRYSPVKNEEDVAELSISPLDNAVVLTNLLPGTEYLVSVSSVYEQH
ESVPLRGREKTRLDSPTGIDFSEITTNSFTVHWIAPRAPITGYKIRHHPEHFSGRPREDR
VPPNRNSITLSNLIPGTEYVVSIVALYGREESQPLVGQQPTVSDTPRDLEVIASTPTSLL
ISWEPPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISNLKPGADYTITLYAIVGRG
DSPASSKPVSIDYRTEIGKPSEMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNGQGPS
KSKTVGPDETEMTIEGLQPTVEYVVSVYAQNQNGESQPLVQTAVTNIDRPKGLTFTDVDV
DSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELKGLRPGSEYTVSVVAL
HGDMESQPLIGTQSTAIPPPTNLKFTQVTPTSLSAQWTAPNIQLTGYRVRVTPKDKTGPM
KEIHLSPDSSSVVVSGLMVATKYEVSVSALKDSLTSKPAQGVVTTLENVSPPRRARVTDA
TETTITISWRTKTETITGFQVDAIPTTGQTPVQRIISPDVRSYTITGLQPGTDYKIHLYT
LNDNARSSPVIIDASTAIDAPSNLHFLTTTPNSVLLSWQPPRARITGYIIKYEKPGSPPR
EVVPRPRPGVTEATVTGLEPGTEYTFYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNL
HGPEILDVPSTVQKTPFITTNPGYDTGNGIQLPGTSHQQPSVGQQMIFEEHGFRRTTPPT
AATPVRLRPQPYTPNVDEEIQIGHVPRGDVDYHLYPHVLGLNPNASTGQEALSQTTISWT
PFQESSEYIISCNPVGTDDEPLQFRVPGTSSAATLTGLTRGTTYXXXXXXXXXXXXXXXX
XXXXXXXXXXNEGLNQPTDDSCFDPYTVSNYAIGEEWERLSESGFKLTCQCLGFGSGHFK
CDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHV
GEQWQKEYLGAICSCTCFGGQRGWRCDNCRSPEGNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSDORP00000009522 ENSDORP00000009522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]