SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009592 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009592
Domain Number 1 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 2 Region: 272-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.89e-30
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.58e-21
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009592   Gene: ENSDORG00000010205   Transcript: ENSDORT00000010205
Sequence length 1016
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5959:20264:235339:1 gene:ENSDORG00000010205 transcript:ENSDORT00000010205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKAKGRSRAGTHFESARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLHKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNRLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSTVSQSEPKGNGSINKRLPSIVEDEEEEEGEE
EETASLSPIYTRRSSSSLSKKIGSNKSYLGLSLKQLASGTVPFHSPIRVSSSNSPQTKQE
VELPNHGKKKEKNLKLQLSTLNSTGPPDLSPRIVDGIEDGNSSEESQTFDFTSERIRSEP
RISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGRDMRNVMQLLENVLS
PQQSTQFCSLHSTSVCPSQESLQTRISWSTHQPCLHLQTGGAAYTQAQLCRGNVAPDIWN
VNPSFVGGSPPRTEAHEPSPVGSELLHSPNLDYSPSHYQVVRHLLRCISPHSDMTL
Download sequence
Identical sequences ENSDORP00000009592 ENSDORP00000009592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]