SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009834 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009834
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00000000471
Family Cgl1923-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009834   Gene: ENSDORG00000010464   Transcript: ENSDORT00000010463
Sequence length 264
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1206:24139:48841:1 gene:ENSDORG00000010464 transcript:ENSDORT00000010463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESVPDLTGFTLLMPAVSVGNVGQLAMDLIISTLDMSKIGYFYTDCLVPMVGNNP
YATAEENSTELSINAEVYSLPSRKLVALQLRSIFIKYKARPFCEKLLSWVKSSHCSRVIV
LSSSHSSHCNDLQLRSTPFRYLLTPSMQKGVLNKIKSLNWEEMEKSPCIPQMNDSELCIR
IPGGGITKALYDESCSKEIQMAILLKFVSEGDNIPDALGLVGYLNEWLQIIKPCSEDPTA
SALPWKLPSSWRLLFGSGLPPALF
Download sequence
Identical sequences A0A1S3G1T0
ENSDORP00000009834 ENSDORP00000009834 XP_012882610.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]