SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009929 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009929
Domain Number 1 Region: 26-360
Classification Level Classification E-value
Superfamily UROD/MetE-like 9.42e-101
Family Uroporphyrinogen decarboxylase, UROD 0.0000000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009929   Gene: ENSDORG00000010564   Transcript: ENSDORT00000010565
Sequence length 364
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2482:12580:17007:1 gene:ENSDORG00000010564 transcript:ENSDORT00000010565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGSGPLGLPDLSTDTFLRSSWGKSNYTPVWCMRQAGCYLSEFRETRANQDFFSTCRS
PEACCELTLQPLQRFPVDVAIIFSDILVVPQALGIEVTMVPGKGPSFPEPLRDERDLERL
RDPAVVASELGYVFQAITLTRKRLAGRVPLIGFAGAPWTLMTYMIEGGGSNTMAQAKRWL
YQKPQASHQLLRILTDALVPYLVGQVAAGAQXXXXXXSHAGHGPQLNKFALPYIRDIAKR
VKAGLQKAGLAPVPMIIFAKDGHFALDELAQAGYEVVGLDWTMTPKKARERVGKTVTLQG
NLDPCALYASEEEIGQLVQQMLDDFGPRRYIANLGHGLYPDMDPEHGGAFVDAVHRNSRR
LQKN
Download sequence
Identical sequences ENSDORP00000009929 ENSDORP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]