SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010014 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010014
Domain Number 1 Region: 844-1132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.0000000000395
Further Details:      
 
Domain Number 2 Region: 569-757
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-24
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 394-472
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000185
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 469-563
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000268
Family Fibronectin type III 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010014
Domain Number - Region: 249-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.007
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 157-237
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0197
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010014   Gene: ENSDORG00000010652   Transcript: ENSDORT00000010652
Sequence length 1149
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2217:5457:109880:1 gene:ENSDORG00000010652 transcript:ENSDORT00000010652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSGLVKGSGPHAHLWPLDGEIWGSMDSLAGLILYGLSFLLSGLVEGAMDLILINSLPLV
SDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASK
INGAYFCEGRVRGQSIKIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVI
YKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQK
WGPECTWDCTTCMNNGVCHEDTGECICPPGFMGKTCEKACELHTFGRTCKERCSGPEGCK
SYVFCLPDPYGCSCATGWQGLQCNQCQPGYYGPDCKLRCSCSKGEMCDRFQGCLCSQGWQ
GLRCERECMPRRTPQIEDLPDLIEVNSGKFSPICKASGWPLPANEEMTLVKPDGTVLHPN
DFNHTDHVSVAIFTIHQILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDT
GHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWRHIQVTNEIVTLSYLEPRTEYELC
VQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLSLLPKDQTTLNLTWQPIFTNSEDEFYV
EVERRSVQKKSDQQNIKVPGNLTSVLLNNLKPREQYIVRARVNTKAQGEWSEDLTAWTLS
NIIPPQPENIKISNVTDTSAVISWTILDGHSISSIIIRYKVQGENEDQHIDVKIKNATIT
QYQLKGLEPETAYQVDIFAENNIGSSNPTFSHELMTLSESQASADLGGGKMLLIAILGSA
GMTCLTVLLAFLIMLQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKAKNNPDPTI
YPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEV
LCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTAST
LSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYIAKIADFGLSRGQEVYVKK
TMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGY
RLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAG
IDCSAEEAA
Download sequence
Identical sequences ENSDORP00000010014 ENSDORP00000010014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]