SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010023 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010023
Domain Number 1 Region: 200-333
Classification Level Classification E-value
Superfamily C-type lectin-like 5.47e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 2 Region: 790-916
Classification Level Classification E-value
Superfamily C-type lectin-like 1.82e-31
Family C-type lectin domain 0.0005
Further Details:      
 
Domain Number 3 Region: 624-774
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-28
Family C-type lectin domain 0.00065
Further Details:      
 
Domain Number 4 Region: 1099-1225
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 929-1080
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-25
Family C-type lectin domain 0.00062
Further Details:      
 
Domain Number 6 Region: 6-137
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.46e-23
Family Cysteine rich domain 0.0045
Further Details:      
 
Domain Number 7 Region: 384-469
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-22
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 8 Region: 481-616
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-22
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 137-195
Classification Level Classification E-value
Superfamily Kringle-like 2e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 10 Region: 1220-1319
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-17
Family C-type lectin domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010023   Gene: ENSDORG00000010661   Transcript: ENSDORT00000010661
Sequence length 1327
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3752:67120:112305:1 gene:ENSDORG00000010661 transcript:ENSDORT00000010661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALPEADIFLIFSHGLQGCLESQGAKVRVTPACNTSLPAQRWKWVSRNRLFNLGAMQCLG
TGWPGTNSTASLGMYECDREALSLRWQCRTLGDQLSHLLGGSTGNASKPGPLERGDHTRS
GQWRIYGSEEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCAT
TQDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLS
ITEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPNEENC
GVIRTESSGGWQNRDCSIALPYVCKKKPNSTTELTPPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSIHSMAELEIKQIKQEVEELWIGLNDLKLQMNFEWSD
GSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEE
DHGCRKGWTWYSSSCYWLGEDQVTYSEARRXXXXXXXXXXXXXXXFEQAFVSSLIYNWEG
QYFWTALQDLNGTGSFHWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTS
FRARYICRQSLGTPVTPELPGPDPTPSLAGSCPQGWASDPKLRYCYKVFSSERLQDKKSW
IQAQGNCQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPREGQ
SWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGTEVR
KPDVSPQGRREWLRFQDAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQDELDFLGHNLQ
KFSRGQEQHWWIGLHTSESDGRXXWTDGSIINFISWAAGKPRPPGKEKKCVYMTASREDW
GDQRCLTALPYICKRTNNTGQTQLPDLPPPALGGCPSGWSQFLNKXXXXXXXXAPPRTRV
KWSEAQFCEQQEAQLITIANPLEQAFITAKLPNVTFDLWTGLHASQRDFQWVEQEPLLYT
NWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEEAHGFICQKGTDLSLS
PSPAASPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESRNTSLAHVPDPYTQAFLTQAA
RGLRVPLWIGLASEEGSRQYSWVSEEPLSYMNWQDGEPQHSGGCTYLDVDGAWHTTSCDT
KLQGAVCGVNRGPPPPRRINYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQ
RVGGAVLSILDEMENVFVWEHLQSSEGQNRGAWLGMNFNPKGGTLVWQHTVVNYSNWGSP
GLSSMLS
Download sequence
Identical sequences ENSDORP00000010023 ENSDORP00000010023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]