SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010031 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010031
Domain Number 1 Region: 11-79
Classification Level Classification E-value
Superfamily Tim10-like 5.36e-19
Family Tim10/DDP 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010031   Gene: ENSDORG00000010671   Transcript: ENSDORT00000010670
Sequence length 100
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_9480:38215:38866:1 gene:ENSDORG00000010671 transcript:ENSDORT00000010670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRSLDAEEEACLHSCAGKLIHSNHRL
MAAYVQLMPALVQRRIADYEAASAAPGVTEEQPNVSPSGS
Download sequence
Identical sequences A0A1S3GQ87
XP_012891053.1.60039 ENSDORP00000010031 ENSDORP00000010031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]