SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010119 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010119
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.06e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.00000113
Further Details:      
 
Domain Number 2 Region: 133-242
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.3e-20
Family Middle domain of MutM-like DNA repair proteins 0.00000442
Further Details:      
 
Domain Number 3 Region: 246-273
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000485
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010119   Gene: ENSDORG00000010769   Transcript: ENSDORT00000010769
Sequence length 388
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3355:4674:7895:1 gene:ENSDORG00000010769 transcript:ENSDORT00000010769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELRLAALYVNRACAELVFAGRVEKSEVSRNPEVPFESSAYRIAASTRGKELRLTL
SPLPGARPPRQPLPIVFRFGMSGSFRLAPAGQLPRHAHLRFYTAPPAPPQALCFVDVRRF
GRWDPGGHWHPGRGPCVLLEYQQFREVLRNLSDKVFDRPICEALLDQRFFNGIGYLRAEI
LHRLKIPPFERARTVLEALKQHRPSPELTLSQKIRARLQNPDLLELCHLLPKEVVRLGGK
GYGSEQGEEDFAVFRDWLRCYGVPGMSSMRDGHXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRRRPQKTKASTPSGESGGTPAS
Download sequence
Identical sequences ENSDORP00000010119 ENSDORP00000010119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]