SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010134 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010134
Domain Number 1 Region: 18-110
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 2.39e-30
Family VPS28 N-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 123-186
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 4.71e-21
Family VPS28 C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010134   Gene: ENSDORG00000010786   Transcript: ENSDORT00000010786
Sequence length 213
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3810:10074:13384:-1 gene:ENSDORG00000010786 transcript:ENSDORT00000010786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSLLQYKAAFRQVQGSEINSIDEFCRKFRLDCPLAMERIKEDRPITIKDDK
GNLNRCIADVVSLFITIMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQ
WVTFLGMQTASVPRPHTHTLCPQVADPERHVCV
Download sequence
Identical sequences ENSDORP00000010134 ENSDORP00000010134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]