SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010199 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010199
Domain Number 1 Region: 396-657
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-42
Family YWTD domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 3199-3405
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-39
Family YWTD domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 1747-2013
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-34
Family YWTD domain 0.0000835
Further Details:      
 
Domain Number 4 Region: 1439-1639
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-33
Family YWTD domain 0.0000488
Further Details:      
 
Domain Number 5 Region: 2472-2646
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-30
Family YWTD domain 0.0000335
Further Details:      
 
Domain Number 6 Region: 2067-2335
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-27
Family YWTD domain 0.0000741
Further Details:      
 
Domain Number 7 Region: 839-969
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-17
Family YWTD domain 0.00039
Further Details:      
 
Domain Number 8 Region: 292-385,650-706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 9 Region: 2734-2776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 3144-3193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000167
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 11 Region: 102-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 1265-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 13 Region: 1106-1144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 14 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 1148-1185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000956
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 16 Region: 2987-3028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 3112-3158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000384
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 18 Region: 3795-3834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 19 Region: 2857-2897
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 20 Region: 3070-3110
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 21 Region: 3718-3755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3510-3545
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 3926-3962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 1066-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 25 Region: 2903-2940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 26 Region: 1230-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 27 Region: 3027-3069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2699-2736
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 29 Region: 3841-3878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 30 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 31 Region: 1187-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 32 Region: 1022-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 33 Region: 221-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 34 Region: 1354-1401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000733
Family EGF-type module 0.012
Further Details:      
 
Domain Number 35 Region: 4060-4191
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000942
Family YWTD domain 0.0014
Further Details:      
 
Domain Number 36 Region: 66-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 37 Region: 182-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 2820-2859
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 39 Region: 2944-2987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000916
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 3882-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 41 Region: 1391-1430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 42 Region: 2020-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.025
Further Details:      
 
Domain Number 43 Region: 1311-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 44 Region: 3679-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 45 Region: 3547-3588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 46 Region: 4007-4041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 47 Region: 147-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 48 Region: 4379-4410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000282
Family EGF-type module 0.02
Further Details:      
 
Domain Number 49 Region: 2779-2818
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000432
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010199
Domain Number - Region: 3969-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000301
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 2342-2387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1704-1754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000652
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 3468-3529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00217
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 980-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0027
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4326-4409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number - Region: 734-773
Classification Level Classification E-value
Superfamily YWTD domain 0.0405
Family YWTD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010199   Gene: ENSDORG00000010845   Transcript: ENSDORT00000010852
Sequence length 4650
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_729:19316:197254:-1 gene:ENSDORG00000010845 transcript:ENSDORT00000010852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAAAVAGTLLLALAASLVPVRGQECDSGHFRCGNGRCIPAAWRCDGTRDCLDDTDEI
GCPHSSCQTGYFMCQDDGSCIPHSWVCDQEDDCTDGSDEHQHCPGVTCSSHQLTCSNGQC
IPREYRCDHVRDCSDGSDEKDCQYPTCEQLTCASGACYNTSQKCDQKIDCRDSSDEANCT
GMCTHSEFECGNGECIPRAYICDHDLDCDDGTDEHNCEYESCGGHQFTCPSGQCIHQNWV
CDGDDDCQDNADEDGCESSHHRYHTCYPREWACPKSGKCISIFQVCDGVSDCPEGEDETN
TTSGRNCDMSMCSVLNCEYQCHKTPSGGACFCPPASIINHNDSRTCLDFDDCKIWGICDQ
KCENRFGHHLCHCEEGYILEREQHCRANDSFQEASIIFSNGRDLIIGDIHGRSFQILVES
QNRGVAVGVDFHYRLHKVFWTDPVRDKVFSVDINGVNIQEVLNASVEAPENLAVDWINNK
LYLVETKVNRIDMVNLDGSQRVTLITENLGHPRGIALDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGITLDIVSQRVYWVDSRYDYVETVTYDGIQRKTVVHGGSL
IPHPYGISLFEDHVFFSDWTKMAVMKANKFTEPHPQVYHQSSLRTYGVTVYHALRQPNAS
NPCEVNNGGCEQICVLSHRTDNDGLGYRCKCTFGFELAADERHCVAVKNFLIFSSQLAVR
GIPFTQSVQEDVMVPVTGSLSFFVGIDFDAQERTIFFSDTSKDLIYKQKIDGTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYI
FFSDWFRPAKIFRAWGDGSHLMPIVNTTLGWPNALAIDWGASRLYWVDAFFDKIEHSTFA
GLDRRRLGHIEQMTHPFGITIFKDSVFFTDWRLGAIVQVRKSDGGGMTVIRNGITNIMHV
KSYDTDIQTGSNFCSQPTLPNGDCSHFCFPVPNFQRVCGCPYGMKLTSNQQTCEEDPVHE
PPTEQCGSFSFACDNGKCVPNFYRCDGVDDCHDNSDERLCGAFNNTCSSLAFACAHGGQC
IPGRWRCDRHNDCADGSDEQNCPTYAPTVCPQSYFTCDNNHCISRSWVCDTDNDCGDGSD
EKNCESSQTCQPSQFRCPDHRCIDPSFVCDGDKDCADGSDEIGCVLNCTSLQFKCADGSE
CITKSYRCDGVFDCADNSDETGCPTRPPGMCHPDEFQCQGDGVCIPNTWECDGHSDCIDG
SDEHHGCVPKTCSASQFRCDNGNCIFKEWICDGDNDCRDMSDEKDCPPPPFRCPSWQWQC
PGFSICVNLSALCDGVFDCPNGTDESPLCNQDSCSNFNGGCTHQCVQGPFGARCVCPLGY
QLANDTKTCEDINECDVPGFCSQHCYNMRGSFRCSCDQDYMLEDDGRTCKVTASESLLLL
VSSLNKVIADNITSQVHNIYSLIQDGSYIVAIDFDSVSGRIFWSDLRQGKAWSAFQNGTD
RRVIHDSGMFVTESIAVDWIGRNLYWTDYILETIEVSKIDGSHRTVLISKNVTNPRGLAL
DPRTNEHLMFWSDWGRHPRIERASMDGTSRTVIVQDKIYWPCGLTIDYPNRLLYFLDAYH
DYIDFCDYDGHNRRQVVASSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPNPCASSPCSHLCLLSTQGPRYYSCACPSGWNLSHDSVN
CMRGDQPFLMSVQNSIIFGISLDPEVKSNDAMVPIPGVQNGFDVEFDDSEQFIYWVENPG
EMHRVKTDGTNRTVFAPLSLLGSSMSLALDWISRNIYYTTPASYSIEVLTLRGDVRYRKT
LITNDGTALGVGYPVGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSLKTLFTGNLE
HLEVVTLDIKEQKLYWAVTSRGVIERGNVDGTERMILVHHLAHPWGLAIFDAFLFYSDEQ
YEVIERVDKVSGDNKVVLRDNVPGLKGLRVYHRRSIGESSNGCSNNMNACQQICLPVPGG
LFSCACATGFNLNPDHRTCSPYNSFIVVSMLYAIRGFSLELSDHSEAMVPVAGQGRNVLH
VDVDVVAGFIYWCDFNSSVSSYNAINRIKSDGSSXXXXXXXXXXXXXXXXXXXXXXXXNL
YFTNAFGYETMIEVLRINTTYRRILLKATVDMPRHIVVDPKNRYLFWADYGQKPKIERAF
LDCTNRTVLVSEGIVTPRGLAMDHSNGYIYWVDDSLDLIARIHLSGGESEVIRYGSRYPT
PYGITVFGDSIIWVDRNLKKVFQASKEPGNTDPPTVLRDNISWLRDVTVFDERAQPRTQA
EINHNPCLENNGGCSHFCFALPELPTPKCGCAFGTLESNGKNCTISTENFLIFALGNSLR
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXGTADGIFDWINRRIYYSDFLNQTINSMAEDGSQHTVVARSTRPRDIVLDPCRGY
MYWTAWGMVAKIERATLAGNFRVPIVNTSLVWPNGLILDFETDLLYWADASLQKIERSTL
TGTGREVVVGASFHPFRLTLYGQYIYWTDYFSQKIYRANKYDGSDLIPMTTNLFFQPRDI
CVVRKDEQQHCSNPCDQFNGGCSHICAPGPNGAECQCPHVGDWYLANNNKHCIMDKGSRC
DASQFTCLNGHCIREQWKCDNDNDCGDGSDELESVCAFHTCRPTAFTCGNGRCVPYSYRC
DYYDDCGDNSDEAGCLFRTCNSTTNFTCSNGRCISLQLVCNGMNNCFDNDTSNEKNCPDR
TCQSGYTKCQTTNICIPRTYLCDGDNDCGDMSDENPTFCTTQTCSSTEFQCTSSWRCIPH
HWHCDGDVDCPDGSDEPASCAYAERTCLEREFKCDAGRCIPRAWICDGDNDCGDMSDEDE
RHHCENQTCSSSEFLCANNRPPDRRCIPKVWVCDGDADCSDALDEHQNCTRRSCSADEFT
CGNGLCIRQSFRCDHRNDCGDYSDERGCSYPTCPGTHFTCQNARCVYKQYVCDGENDCGD
ESDELDHLCHTPAPTCPPHQFKCDNGRCIEMGNVCNHVDDCTDNSDEKGCGINECEPSIS
GCDHNCTDTLTSFYCSCLPGYKLMSDKRSCADIDECLETPQVCSQKCENEVGSYICKCAP
GYIREPDGKTCRQISNIEPYLIFSNRYYLRNLTTNGYSYSLILQGLSNVVALDFDRVEKR
LYWIDKERQVIERMFVNKTNRETIISHRLPAAESLAVDWVARKLYWLDANLDCLFVSDLE
GRYRRTLAQHCVDANNTFCFENPRGIVLHPQNGHLYWADWGHRAYIGRIGMDGANKSVII
STKLEWPNAITIDYTNDLLYWADAHLGYIEYSDLEGRHRHTVYDGILAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNPCAINNGGCSHLC
LIKAGGQGFTCECPDDFQTIHLSDRTLCLPMCSSTQFLCADNEKCIPIWWKCDGQKDCAD
GSDESALCPQRFCQLGQFQCRDDNCTSPQSLCNVDRNCPDGSDEDSALCENHRCESNXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSAAYNCDNHTEFSCKTNYRCVPQWAVCDGVDDCRDNSDEQGCEELTCN
PSGDFRCANHHCIPLRWKCDGQDDCGDNSDEENCXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXMMTCHPEDFQCTSGHCISNQLKCDGTADCLDASDETTCPTRFPNGA
YCPASMFECENHVCIQPRWICDGDNDCVDGSDEELHLCFNVTCEAPSRFRCDNGRCIYFH
QLCNTLDDCGDGTDEKVEHCRKPTPKPCTEEEFKCGNGNCILQHYICDNVDDCGDRSDEI
GCNLGKERTCAENLCEHNCTQLNEGGFICSCRTGFKADTLDRNSCQDINECEQFGICPQN
CENTKGSYECFCASGFQSMSTHHGERCAADGDPPLFLLPENVRIRKYNISSKKYSEYLEE
EEHIQSIDYDWDPEGIGLSVVYYTVLAQGSNFGAIKRAYIPNFESGSNNPMQEVDLGLKY
IMQPDGLAVDWVGRHIYWSDAKSQRIEVARLDGRYRKWLITTQLDQPAAIVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNKPYNLDIFEDQLYWVAKEKGEVWTQNKFGQGNKEKMLSVNPWLTQVRI
FHQLRYNQSVSNPCKQICSHLCLLRPGGYSCACPQGSSFLAGSTVECDAAIELPVMAPCR
CMHGGSCYFDENDLPKCKCSSGYTGAYCEIGLSKGLPPGTTAAMAVLLTFLLIIIIGALL
LVGFFHYKKTGSLLPALPKLPGLSSLVKPSENGSGVTFXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTISENVENKNYGSPIDPSEI
EPEPKPTSPSADGTQASKWSIFKRKLKQTSNFENPIYAEMDNEPKESVAVAPPPSPSVPE
CSKRDPSIGYTATEDTFKDTANLVKEDSEA
Download sequence
Identical sequences ENSDORP00000010199 ENSDORP00000010199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]