SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010293 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010293
Domain Number 1 Region: 427-657
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-55
Family Protein kinases, catalytic subunit 0.00000347
Further Details:      
 
Domain Number 2 Region: 252-365
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-33
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 35-123
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-22
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010293   Gene: ENSDORG00000010949   Transcript: ENSDORT00000010949
Sequence length 910
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5151:26325:61231:-1 gene:ENSDORG00000010949 transcript:ENSDORT00000010949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEVPDPNDPLGQPDGQDSPSPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPSV
RWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGVKTITATGVLYVR
LGPTHSPNHNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAFTMI
GTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLESELCRQEYTIARS
NPLILMRLQLPKCEALPMPESPAAANCMRIGIPAERLGRYHQCYNGSGSDYRGMASTTKS
GHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPS
CXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXAKLKEISLSTVRFTEELGEDRFGKVYKGHLFGPTPGEQTQAVAVKTLKDKA
EGALREEFRHEAMLRARLQHPNLVCMLGVVTKDQPLSMIFSYCPHGDLHEFLVMRSPHSD
VGSTDDDRTVKSALEPPDFVHVVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVKISD
LGLFREVYSADYHKLTGNSLLPIRWMSPEAIMYGKFSIDSDIWFYGVVLWEVFSYGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXQPVPAYGAYLPNFYPVQIPIQMAPQQVPPQVVPKPSSCHSGSGSTSTGY
VTTAPSNTSVADRAAVLSEGTEDTQNIPEDVTHNPVQEAEEEEEGSVPETELLGDSDALQ
VDEAQVQMEA
Download sequence
Identical sequences ENSDORP00000010293 ENSDORP00000010293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]