SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010434 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010434
Domain Number 1 Region: 161-303
Classification Level Classification E-value
Superfamily vWA-like 0.0000000125
Family Trunk domain of Sec23/24 0.059
Further Details:      
 
Domain Number 2 Region: 663-771
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000761
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010434   Gene: ENSDORG00000011104   Transcript: ENSDORT00000011104
Sequence length 1223
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4366:23688:238209:1 gene:ENSDORG00000011104 transcript:ENSDORT00000011104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLAAEELGVVTMQRIFNSFVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRNKQVVE
ASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLN
SVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVV
ILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADTVRTCSLDQCYKTFLSPATS
ETKRKMSTFVSSVKSSDNPTQHAVGFQKAFQLIRNTNNNTRFQANTDMVIIYLSAGITSK
DSSEEDKKATLRVINEENSFLNNSVMILTYALMNXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIMTVSK
PCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPYLLSEP
PLHTDIIHYENIPKFELVRQNILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVQDTSFILCIVVIQPEIPVRQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLE
NPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHV
TDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLIS
LTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLPVCNQD
GGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVKKNLCN
SFSDRTVQRFYKFNTSLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRMEQNECECPCECPLEVNECTGNLTNAENXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDCFGVLDCEWCMVDSDGKTHLDKSYCAPQKECFGGIVGAK
SPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSP
LAAQEMSVRMSNLENDRDERDEDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGT
ESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHEEDLDLDTPPQTAALLSHKFHHYRSP
HPTLHHSHHLQAAVTVHSVDAEC
Download sequence
Identical sequences ENSDORP00000010434 ENSDORP00000010434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]