SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010489 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010489
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000183
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010489   Gene: ENSDORG00000011162   Transcript: ENSDORT00000011162
Sequence length 195
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4858:4124:16220:-1 gene:ENSDORG00000011162 transcript:ENSDORT00000011162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV
QQQHQPQQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHM
NASSMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVI
PQMQPGGVQAPVIQQ
Download sequence
Identical sequences ENSDORP00000010489 ENSDORP00000010489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]