SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010536 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010536
Domain Number 1 Region: 101-285
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.89e-51
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010536   Gene: ENSDORG00000011215   Transcript: ENSDORT00000011214
Sequence length 293
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_8903:5282:23313:1 gene:ENSDORG00000011215 transcript:ENSDORT00000011214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEPAPGAGGAGTPSGAVPVLFCFSVFARPSSVPHGAGHELLIQKFLSLYGDQVDAHR
KFVVQLFAEEWGQYVDLPKGFAVSGRCRLRLVPLQVQLTTLGNLTPSSTVFFCCDMQERF
RPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTKFS
MVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSRSMMDRM
FALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKVE
Download sequence
Identical sequences ENSDORP00000010536 ENSDORP00000010536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]