SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010549 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010549
Domain Number 1 Region: 97-260
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000000308
Family FKBP immunophilin/proline isomerase 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010549
Domain Number - Region: 838-922
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0173
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010549   Gene: ENSDORG00000011225   Transcript: ENSDORT00000011227
Sequence length 1220
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2566:36978:112654:-1 gene:ENSDORG00000011225 transcript:ENSDORT00000011227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGGGDRGNIRLPRCNRTNADAMFGAEDEDYTDFLSPSGGXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXNQTPPKPAPAPTGTAAVLVATAVHAYRYINGQYLKQGKFGAA
VLGNHTARDYRILLYISQQQPVTVARIHLNFELVVRPNNYSTFYDDQRQNWSIMFESEKA
AVEFNKQVCIAKCNSTPSFDAVVSQDLVVTEGPAVENGDSLEVAYTGWLFQNHVLGQVFD
STANKDKLLRLKLGSGKVIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNPDTVKAKLISRMAKMGQPMLPILPPQLESNDSEVEEITALRGA
EQPLVTPSSQPPLQPVHPVLPQMASQAAQPSVSGLQAPSPALMQVTSLDSHSAVSGNAQS
FQPYAGIQAYAYPQASAVTSQLQPVRPLYPVPLSQAPHFQGSGDMTSFLMTEARQSNTEI
RMAVSKVADKMDHLMAKVEELRKQSAGSSMLIPGMSVTLDTTMIMSNIPRIILEEERLMQ
EIHEKNSWIDVKDSSSKLIENQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKV
TEELAAATAQVSHLQLKMTAHQKKETELQMQLTESLKETDVLRGQLTKLQAELSEFQKTF
EQSQSKFKSEKQSRKQLELKVTSLEEELTDLRTEKESLEKNLSERKKKSAQERCQAEEEM
EEIRKSHQEELNKLHQLLKKARVSTDQAAAVQLSVAQAELQNHWEAKCEHLLASAKDEHL
QQYQEACTQRDAYLQELTRLQEKCSALQTQVTTLTEQNDRHIKELEKTKSQVSGVKTAAD
PSEKVKKIMNQVFHSLRGEFELEESYDGRTILGTIMSTIKMVTLQLLNQQEREQGVSSSE
EEEERLPPQEQTGPATAEPCPVPTGGEREEAPEVPLEQVAEEADLLPAPRGRHRREGEPS
EAETLSEVQDGSLPPPRALGPLALIPPEPSSPAAVDSEFEESPAAGLVAASPDNPLDKVD
VGEVAPDGPPRGSSRRQTLTPDPEKGEPPALGPESPGGEPEPPELSDDARAPRPAAPHKA
PSGTEASPAGAALRPSHGSPHSSLSGDKEDELFPGATLKVPRPKAQPEDEDEDEVSMKGR
PPPTPLFGDDDDDDDIDWLG
Download sequence
Identical sequences ENSDORP00000010549 ENSDORP00000010549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]