SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010587 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010587
Domain Number 1 Region: 336-436
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.88e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010587
Domain Number - Region: 187-242
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0239
Family N-terminal PAS domain of Pas kinase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010587   Gene: ENSDORG00000011263   Transcript: ENSDORT00000011267
Sequence length 1248
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4830:6828:39384:-1 gene:ENSDORG00000011263 transcript:ENSDORT00000011267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYTDFPRSPSSPAEASKETQPGQAALQEDVDMSSGSSGNETNGNCSTGRGSQASDCED
SGKELGMLVEAPDSHQSPNAFSLLMAETEHNPSTSTSGCSSEQSSKADTHKELIRTLREL
KVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTVEQV
EGTTSEYIMQNADMFAVAVSLVTGKILYISNQVASIFHCKRDAFSDTKFVEFLAPHDVSV
FHSSTTPYKLPSWSVCGVVDSFSQECMEEKSFFCRVSVGKRHEHEIHYQPFRMTPYLAKV
QEQRAPESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLP
QDLIETPLLMQIHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFI
NPWSRKISFIIGRHRVRVGPLNEDVFAAPPGVEEKAPHPSIQELTEQIHRLLLQPIPHSG
SSGYGSLGSNGSHEHLMSQTSSSDSNGHEEARRRRSEISKNGSKSKTKSHFSHEAGAQKK
TSVPEIQSSPPATQVKVVPATEESPGVSSPKAGFPEELACKNQPACSYQQISCLDSVIRY
LESCSEASTLKRKCEFPAHIPSRKATVSPGLHPGEASAPCKVNSHAEVSAHLTSLTLPSK
AESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDAASGPESLDGLLGLNQEKGPLQKLGL
TKEVLAAHTQREEQGFLQRFREVRRLGALQAHCQYYLQERSRAQSGERAAPGLKNSSGLE
SSWKKAGKNRKLKSKRAKPQDSSDSTGSGGPWPHRPPLVGLNTTAWSPSDTSQSSCSAVP
FPAPVSAYSLPVFPAPGAVAAPPAVPQASFAVPVVPVDAQHEFAVQPLQLAAPLAPVMAL
MLPSYPFPPATPNLPQAFFPNQAHFPDHPMLPSEMTATPQPEFPSQTSLLRQPCTCPATP
ATPPLSATAATGRASPPLFQSRGSSPLQLNLLQLEEAPEVSAGATGAPGTAGLDSIPGAS
QDWQPKAPPTHKEPSDPPNSDALSTSSDLLNLLLNEDLCSATGSATSDSLGSSSLGCDAS
RSGAGSSDTSHTSKYFGSIDSSENNHKAKLHADMEESEHFIKYVLQDPIWLLMADTDDSI
MMTYQLPSRDLETVLKEDREKLRLLQGSQPQFTESQRRELLEVHPWVQTGSLPSAIDVTE
CVYCESEERDNACVPYEEGISSLGLSDMSDTKEEESRGPLSPRKEEQT
Download sequence
Identical sequences ENSDORP00000010587 ENSDORP00000010587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]