SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010730 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010730
Domain Number 1 Region: 5-413
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 5.54e-158
Family Phosphoglycerate kinase 0.00000000000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010730   Gene: ENSDORG00000011418   Transcript: ENSDORT00000011417
Sequence length 414
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_6686:17080:18550:-1 gene:ENSDORG00000011418 transcript:ENSDORT00000011417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVLMRVDFNVPMKNNITNTQRIRAAVPSIQHCLDYGAKAVVLM
SHLGRLDGMLRPDKYSLEPVVSELKTLLGRDVFLKDCVGPEVEKACASLAPGAVILLENL
RFHLEEGKGQGRSGSKVKADPDKVQAFRASLSRLGDVYVNDAFGTAHRAHSSMVGVELPQ
RAAGFLMKKELEYFARALEKPERPFLAILGGAKVADKIQLIRNMLDKVNHMIIGGGMAYT
FLKVQSNMEIGASLFDEEGAKIVKDIMDKAEKNGVKMTLPVDFVTGDKFEEGAKVGQATV
ESGIPAGWMGLDCGPESMKKNAEVVAQAKMILWNGPLGVFEWDAFAKGTKALMDEIVKAT
AKGCVTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVEALNNL
Download sequence
Identical sequences ENSDORP00000010730 ENSDORP00000010730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]