SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010822 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010822
Domain Number 1 Region: 450-558,680-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.93e-50
Family Phosphate binding protein-like 0.0000000182
Further Details:      
 
Domain Number 2 Region: 65-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010822   Gene: ENSDORG00000011513   Transcript: ENSDORT00000011515
Sequence length 1457
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5919:17052:209011:-1 gene:ENSDORG00000011513 transcript:ENSDORT00000011515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLGYWTLLVLPALLVWRGPTQSQSAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQA
AGLPMDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVVQMLDFISSQT
FVPILGIHGGASMIMADKDPMSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFIGFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYEFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLESRVRDGLGILT
TAASSMLEKFSYIPEAKASCYGQTEKPETPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVT
NGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSN
GTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLK
TGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSLWKRQIDLALLQ
FVGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSA
KNISNMSNMNSSRMDSPKRTADYIQRGSLIVDMASDKGNLIYADNRSFQGKESIFGDNMN
ELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESL
RQDSLSQNPVSQRDEVSVENRTRSLKSPRYLPEEVAHSDISEASSRTACLREPDNNKNHK
TKDNFKRSLASKYPKDCSEVERTFLKTKASSPRDKIYTIDGEKDPPFQLEPPQFVESLTV
PDTYQDHNDNFRKGDATLPVNRNPLHREDGPPNNDQYKLYAKHFTLKDKGSPHSEGSDRY
RQNSTHCRSCLSNLPTYSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKNKLRISRQHSYDNILDKPREIDPSRPSRSISLKDRERLLEGNLYGS
LFSVPSSKLLGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHTYGDDQRLVIGRCPSDPY
KHSLPSQALNDSYLRSSLRSTASYCSRDSRAPSDVYISEHVMPYAANKNNMYSTPRVLNS
CSNRRVYKKMPSIESDV
Download sequence
Identical sequences ENSDORP00000010822 ENSDORP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]