SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010860 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010860
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000432
Family LysM domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010860   Gene: ENSDORG00000011557   Transcript: ENSDORT00000011556
Sequence length 227
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4597:204:9110:-1 gene:ENSDORG00000011557 transcript:ENSDORT00000011556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPIGASGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTIYIPILTEPRDLFNSLDSEEEKDGEEEVHSRKAEARSHS
TERKKRETSSGRANGEVPSTPGHESPPPVHDLSASDFLKKLDLQISLSKKAAAQKLRKGE
SGVPGEHAAVHQSSPRMQQRAVLGPVPLTRTSRTQSLREQEDEIFKL
Download sequence
Identical sequences A0A1S3F3B1
ENSDORP00000010860 ENSDORP00000010860 XP_012870594.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]