SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010979 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010979
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily E set domains 1.82e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000105
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1e-18
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010979   Gene: ENSDORG00000011681   Transcript: ENSDORT00000011681
Sequence length 379
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4008:35207:36346:-1 gene:ENSDORG00000011681 transcript:ENSDORT00000011681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAKVYYSQTTQTESRPLVSPAIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVAPPSGLRDSTVRYGDPEKLKLEES
LREQAEKEGSALSVRISNV
Download sequence
Identical sequences A0A1S3GCM8
ENSDORP00000010979 ENSDORP00000010979 XP_012885999.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]