SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010999 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010999
Domain Number 1 Region: 47-266
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.71e-65
Family Carbonic anhydrase 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010999   Gene: ENSDORG00000011701   Transcript: ENSDORT00000011701
Sequence length 329
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4160:61339:450367:-1 gene:ENSDORG00000011701 transcript:ENSDORT00000011701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISCPRHGTKPNELPTVGLKRNTQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNL
CSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISG
GPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGL
VVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSM
TIPPCYETASWIIMNKPVYITRMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNEWLLK
Download sequence
Identical sequences ENSDORP00000010999 ENSDORP00000010999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]