SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011038 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011038
Domain Number 1 Region: 235-323
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-16
Family Kelch motif 0.0058
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000018
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 3 Region: 366-412
Classification Level Classification E-value
Superfamily Kelch motif 0.0000017
Family Kelch motif 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011038   Gene: ENSDORG00000011744   Transcript: ENSDORT00000011741
Sequence length 413
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6703:3930:15138:1 gene:ENSDORG00000011744 transcript:ENSDORT00000011741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIILQYQSGIVLHCHAAIAGSSNYIKAMFTSDMKKFTNQIILSGYLHDQEGLVNYAYTSQ
IEITKRNVQSLLEAADQLQFLSVKKACEQFLVRHLDIDNCIGMHSFAEFHMCPELEKESR
RILCSRFKEVWQQEEFLEISLEKFLFILSRKNLSVWKEEAVIEPVIKWTAHDVENRIECL
YNLLSYINIDIDPVYLKTALGLQRSCLLTENKIRSLIYSALNPVHKEISQRPTATMYIIG
GYYWHPLSEVHIWDPLTNVWIQGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTV
WIYNSESDTELPMLNARYYHCAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVGNATACVLHEVIYVIGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHP
Download sequence
Identical sequences ENSDORP00000011038 ENSDORP00000011038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]