SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011151 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011151
Domain Number 1 Region: 35-110
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.00000000000209
Family Ribosome-binding factor A, RbfA 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011151   Gene: ENSDORG00000011863   Transcript: ENSDORT00000011862
Sequence length 227
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1200:1764:15071:1 gene:ENSDORG00000011863 transcript:ENSDORT00000011862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKFWYESPSLGSHLAHKPSKLDFLNKKTSKTTTKEDHVRLRTLNGLLLKALTDLLCTPEV
SQEVCDLNVELSKVSLASDFSACRVYWKTGLSADQNKHTEAVLQRSAAHMXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVDELLAAADFGPPDEKDGLAQADLRNPGALSPNDSRGPAVH
SCLCGIDHESLNKKVMEYKRRKEKGLRGVALQQQVAGLTQPVRRKKK
Download sequence
Identical sequences ENSDORP00000011151 ENSDORP00000011151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]