SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011179 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011179
Domain Number 1 Region: 145-392
Classification Level Classification E-value
Superfamily ALDH-like 8.38e-65
Family ALDH-like 0.00000000597
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000393
Family ALDH-like 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011179   Gene: ENSDORG00000011893   Transcript: ENSDORT00000011892
Sequence length 397
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2580:1418:31642:-1 gene:ENSDORG00000011893 transcript:ENSDORT00000011892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCG
QIIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXVGKLIQEAAGRSNLKRVTXXXXXXXXXXXXXXXXX
DYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGP
QIDKKQYNKILDLIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGP
VQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVXXXXXXXXXXXX
XXXXXXXXXXXXXXGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSDORP00000011179 ENSDORP00000011179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]