SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011245 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011245
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 6.38e-73
Family Eukaryotic type heme oxygenase 0.000000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011245   Gene: ENSDORG00000011966   Transcript: ENSDORT00000011964
Sequence length 316
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1322:3902:8260:1 gene:ENSDORG00000011966 transcript:ENSDORT00000011964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVEPSEGVDESEKKNSVASDKENHARVADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIQKELFKLATTALYFTYSALEEEMDRNKDHPAFTPLYFPTELHRKQALIKDMEYFFGEN
WEEQVKCSEAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQFYRARMNALDLNLKTKEKIVEEANRAFEYNMQIFNELDQA
GSMLARETLQDGLPMHDGKGDVRKCPFYAAQQDKGALEGSSCPFRTAIAVLRKPSLQFIL
AACVALAAGLLAWYYM
Download sequence
Identical sequences A0A1S3ETF1
ENSDORP00000011245 XP_012867219.1.60039 ENSDORP00000011245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]