SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011272 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011272
Domain Number 1 Region: 1339-1477
Classification Level Classification E-value
Superfamily PRC-barrel domain 9.42e-63
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000145
Further Details:      
 
Domain Number 2 Region: 239-342
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000157
Family Calponin-homology domain, CH-domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011272   Gene: ENSDORG00000011993   Transcript: ENSDORT00000011993
Sequence length 1484
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2120:8306:79282:1 gene:ENSDORG00000011993 transcript:ENSDORT00000011993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEEFREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVNEHLKDIMEQEQKMKDPHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDCSDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFSLEDMLYAASSIKSNYVVFVAELFWWFEVVKPPFVQPRVIRPHGAEPVKDRPS
IPVLNAAKRNLLDGSSGSDFTSSRGAPWSCHLSSRYSRPHAPSSASGGIRRSSSMSYVDG
FIGTWPKEKRSSVHGVSFDISFDKEDSVPKSTPNRGMTRSISNEGLTLNNNRVSKHIRKN
LSFKPVNGEEEEESIEEELNVDPHTDLKSYMPLNTNELNSNENIPSKLPNGALQNRVLLD
EFGNQIETPSIEEALQIIHDTEKSPHTPRPDQIANGFFLHSQEMSILNSNLKLNQSSPDN
ISDTKGALSPVTDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYD
IRANNPREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQK
TTPEGSELNIPHVVAWAHIPEEPSLPPARDTTQLLASEMVHLRMKLEEKRRAIEAQKKKM
EAAFTKQRQKMGRTAFLTVVKKKGDGISLLREEAAGAEDEKVYTDRVKEKEAHKPDGQRS
KSLADIKESMENLSVWLKSLTHLGGLEKQWNLTSSSEETLNGEILEYTRSIEKLTLHFLQ
QEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKHARDFKPSRQASLSSTTAPFSTDSPRP
AHPSPQASNRKSASFSAKNQRTPRPNDLKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQ
TRSFVCFGDDGEPQLKELKAKEDIKKEDSECKGAPGPHGYNPEEKELKPLESTVSEVLSQ
PVTETVCLTPNEDQLNQPTDPPSKPILPPAAPKNINLIEVSLSDLKPPEKTDVSVEKDDG
ESDKEQFADDEQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKESQLRKQQLEAEME
HKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVKPRPXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSSLSLASLNTGDNESLHSGKRTPRSESVEGFLSPSRCGSR
NGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKI
LEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEISKLTGIGPKSITKKMIEGLYKYNS
DRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTTKA
Download sequence
Identical sequences ENSDORP00000011272 ENSDORP00000011272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]