SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011280 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011280
Domain Number 1 Region: 31-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-42
Family L-arabinose binding protein-like 0.0052
Further Details:      
 
Domain Number 2 Region: 526-545,664-786
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.53e-23
Family Phosphate binding protein-like 0.00000143
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011280
Domain Number - Region: 567-659
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00204
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011280   Gene: ENSDORG00000012002   Transcript: ENSDORT00000012002
Sequence length 914
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4695:17094:229824:-1 gene:ENSDORG00000012002 transcript:ENSDORT00000012002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPWRRLRSLVWEYWAGLLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKWRSATVVYD
DSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFRIIFDCSSMAAQI
KQAMAMGMMTEYYHFIFTTXDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWSME
RLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGGRF
MNFIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGVWSPADGLNITEVAKG
RGPNVTDSLTNRSLIVTTVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDFSKPFMTLGVSI
LYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSE
VVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNN
EEGIQRTLTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDITIAI
LQLQEDLHIMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXRSFCSTVADEIRFSLTCQRRVKHKPQPPMMVKTDAVINMHTFNDRRLPGK
DSMTCSTSLAPVFP
Download sequence
Identical sequences ENSDORP00000011280 ENSDORP00000011280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]