SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011409 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011409
Domain Number 1 Region: 1190-1230,1302-1521
Classification Level Classification E-value
Superfamily NHL repeat 1.31e-16
Family NHL repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 1362-1455,1494-1730
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000149
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 887-958
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000628
Family Carboxypeptidase regulatory domain 0.041
Further Details:      
 
Domain Number 4 Region: 630-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000639
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011409
Domain Number - Region: 696-720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 599-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 727-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 760-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 564-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 534-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2088-2186,2278-2338
Classification Level Classification E-value
Superfamily NHL repeat 0.0837
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011409   Gene: ENSDORG00000012135   Transcript: ENSDORT00000012135
Sequence length 2721
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5956:62181:481757:-1 gene:ENSDORG00000012135 transcript:ENSDORT00000012135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKRKEVEKSTQEMEFCETPHTLCSGYQTDMHNVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSEGENGFKFSPVCCDMEAPAGSTQEV
QNSPHNQFTFRPLPPPPPPPHACTCARKPPPTADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVGQIYANGI
SNGNTGTDSMDSTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQ
ITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMDDCSTNCNGNGE
CISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPTC
FGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSHGICVKGECHCSTGWGGVNCETPLPI
CQEQCSHGTFLLDTGVCSCDPKWTGSDCSTELCTMDCGSHGVCSRGICQCEEGWVGPTCE
ERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQNGW
HCVCQVGWSGTGCNIVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDPLD
LIQQSQPLFSQHSSRLFYDRIKFLIGKDSTHVIPAEISFDSRRACVIRGQVVAIDGTPLV
GVNVSFLHHNDYGFTISRQDGSFDLVAIGGISVVLIFDRSPFLSEKRTLWLPWNQFIVVE
KVIMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIPSS
FVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVYTFA
WNKTDIYGQKVGLAEALVSVGYEYESCPDFILWEQRTVTLQGFEMDASNLGGWSLNKHHI
LNPQSGIIHKGNGENMFISQQPPVIATIMGNGHQRSVACTNCNGPAHNNKLFAPVALASG
PDGSVYVGDFNFVRRIFPSGNSLSILELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITVDRHGFIYFVD
GTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLYVLD
NNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLFIAE
TDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSLAVS
PDGTLYVADLGNVRIRTISKNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTLNLITRD
YVYNFTYNAEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSA
QGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEKLTK
VELDTSNRENVLMSTNVTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEISLSSEPH
ILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNISAFERRLRXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMVRHS
LQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSEILY
DTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFDYSY
NNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTKIFS
ANGQVIEVQYEILKAIAYWMTIQYDHMGRMVICDIRVGVDANITRYFYEYDADGQLQTVS
VNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQRGN
DIFEYNSNGLLQKAYNKVSGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRVTHL
YNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYTPYG
DIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVIAGRWTTPNHHIWKQLNLLPKPF
NLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENLELTYELLQLQ
TKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNEGRCLEGGKQPRFAAVPSVFG
KGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGSLEE
DLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVEEEK
NHVEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVPGYDGYFVLSVEQY
LELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences ENSDORP00000011409 ENSDORP00000011409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]