SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011480 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011480
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-143
Family ALDH-like 0.0000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011480   Gene: ENSDORG00000012210   Transcript: ENSDORT00000012209
Sequence length 487
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2136:68586:85073:-1 gene:ENSDORG00000012210 transcript:ENSDORT00000012209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKDLLMLENFIGGQFLPCHSYIDSYDPSTGEVYCKVPNSGKDEVEVAVEAARGAFPG
WSSQSPEKRAQVLNRLADLLEQSLEELAQAESKDQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRIFVQKSIY
CEFLKRFVEATRKWKVGIPSDPSASMGALISKPHLEKVRSYVKKARAEGAQILCGEGVDM
LSLPPKNQAGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFESEEEVIKRANSVEYGLA
ATVWSSNVGRIHRVAKKLQSGLIWTNCWLIRELNLPFGGMKHSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences ENSDORP00000011480 ENSDORP00000011480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]