SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011559 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011559
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000000265
Family DNA polymerase processivity factor 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011559   Gene: ENSDORG00000012297   Transcript: ENSDORT00000012297
Sequence length 388
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5393:229:5516:1 gene:ENSDORG00000012297 transcript:ENSDORT00000012297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRMGDELYLEPLDDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQVATSDLDTLRCKIQMKSFLSVFRSLAIEERTAECCISLSSRSSSLVIXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLGDAILPFSPALAEVTLGIGRGRRVILRSY
QEEEADSTVKAMVTEMSIGEEDFQQLQAPEGVAITFCLKEFRGLLSFAESANLPLSIHFD
APGRPAIFTIEDSLLDGHFVLATLADLDPHLQYLGSPELPRTAPQLQAHSTSQLDDFASD
DIDSYMIAMETAAGSSGFRAQPPISLSPGFQTSHDPSLHSDEEAEPSTVPGTPPPKKFRS
LFFGSILAPVHSPQGPSPVLAEDSDGEG
Download sequence
Identical sequences ENSDORP00000011559 ENSDORP00000011559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]