SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011570 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011570
Domain Number 1 Region: 411-521,634-784
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.96e-56
Family Phosphate binding protein-like 0.00000829
Further Details:      
 
Domain Number 2 Region: 13-232,278-397
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.38e-26
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011570   Gene: ENSDORG00000012308   Transcript: ENSDORT00000012309
Sequence length 982
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5878:15933:190884:-1 gene:ENSDORG00000012308 transcript:ENSDORT00000012309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGI
LALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPV
RLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNISHVFTS
LFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISNLYLYDSV
LMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDS
SNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKVVTVLEE
PFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTSWNGMIGE
LISKRADLAISAITITPERESVVDFSKRYMDYSVGILIRKPEEKISIFSLFAPFDFAVWA
CIAAAIPVVGVLIFVLNRIQAVRAQSASQPRPTASATLHSAIWIVYGAFVQQGGESSVNS
VAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMPYGTVRDSAV
YEYFRAKGTNPLEQDSTFAELWKAISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVE
YAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWPH
TGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNRCHQETPKE
DKEVNLEQVHRRINSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQLSV
STFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSIQCKHRSPNGGLFRQSPVKTPIPM
SFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSDORP00000011570 ENSDORP00000011570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]