SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011630 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011630
Domain Number 1 Region: 2-31
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.00000000262
Family Nucleoplasmin-like core domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011630   Gene: ENSDORG00000012371   Transcript: ENSDORT00000012370
Sequence length 121
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_15804:26987:30512:-1 gene:ENSDORG00000012371 transcript:ENSDORT00000012370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMSRVELSPPVTFHLRAGSGPVFLSGQECYEISDLSWVDEEGEEEIEEEEEEDFEDEDV
DVSLEDTPVHHGKRLVPHKHISVTKKKKLEKEEEAARSFRDKSPGKKAKITMKIKKLAVK
K
Download sequence
Identical sequences ENSDORP00000011630 ENSDORP00000011630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]