SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011707 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011707
Domain Number 1 Region: 234-360
Classification Level Classification E-value
Superfamily C-type lectin-like 6.89e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1114-1235
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-30
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 3 Region: 807-936
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 4 Region: 656-797
Classification Level Classification E-value
Superfamily C-type lectin-like 9.13e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 37-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.7e-22
Family Cysteine rich domain 0.016
Further Details:      
 
Domain Number 6 Region: 164-221
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-21
Family Fibronectin type II module 0.00091
Further Details:      
 
Domain Number 7 Region: 952-1095
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-18
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 555-643
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000056
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 9 Region: 434-503
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000245
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1321-1379
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000647
Family C-type lectin domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011707
Domain Number - Region: 1239-1279
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00132
Family C-type lectin domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011707   Gene: ENSDORG00000012445   Transcript: ENSDORT00000012450
Sequence length 1459
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4075:37155:169259:-1 gene:ENSDORG00000012445 transcript:ENSDORT00000012450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPLVLLRLLLLRTPRGCAQGGAAASAPEPVLSWRDKGIFIIQSESLKKCIQAGKSVLI
LKDCQQANENMLWKWVSNQHLFNLGGSGCLGLNLSNPEQPLSIYECDSTHVSLRWRCNRK
TITGPFQYMVQGRHDDTVVASRKHHHTWITYMSGSGDICEHLHKDLYTIQGNAYGMPCVF
PFQYKEQWYHECTREGWKDDLLWCATTSRYERDEKWGFCPDPTSANTGCNALWEKDFKSH
ICYQFNLLSSLSWNEAHSSCQMQGGNLLSIADENEETFIKKHLSNEAVEVWIGLNQLDVN
AGWQWSDGTALSYLNWSSGINEPFVEYHCGTFNSFMQPAWRRRNCESAMPYICKKYLNHT
EHTIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXNASETWIGLSSNKIPVSFEWSNSSSVTFTNWHTLEPQIFPNRRQLCVSA
EQSEGHWKVKNCEETLYYTCKKAGQVLSDAQSGCQKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFEQAFITSMISSVVNTKDSYFWIALQDQNDTGEYTWKTAGQRPEPV
QYTHWNVHQPSSNGGCVVMHGRSGRWEVKDCRHFKAMSLCKQPVENREKTEQEERWPFHP
CDLNWESQPGLANCFKVFHSEKVLMKRSWREAEAFCEEFGAHLASFAHIEEENFVNELLH
SKLNRTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLNNSYFGEDVRNCAVYKVDKTL
LPLHCASKREWICKIPRDVRPKIPRWYYYDAPWLFYQNAEYLFYSYPLEWSSFQFVCFLL
NSDILTILSAHEQEFIHSRIRKLSKFGVNWWIGYQEEQANDEIHWRDGSPVIYQNWDRGQ
EIPVNNQSQRCGFISSITGLWGKEHCSMSMPVICKRKKALAVEAEKDTTKQHGTCPKGWL
YFNYKCFLVRIPEDPSNLKNWTGARDFCVEXXXXXXXXXXXXXXXFITMHLFGQTINVWI
GLQDDDYERWLSGKPVVYSNWSPFDVINIPSHNTAEVRKHIPLCALLSSNPNFHFTGKWY
FDDCEKESYGFVCERIQDSEHHINTSDMYPIPSTLAYGNRTYKIINTNVTWHGAVKTCQV
HGAELVSISDQYHQSFLTVILNRLGYAHWIGLFTANNGLSFDWSDGTISTFSFWEEEEPS
FLGDCVFADTNGRWHTAACESFLQGAICHVPPETKPFEHPLLCSETSIPWIKFKSNCYSF
STVLDSLSFEAAHEFCKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
TIRWFDGTPVDQSNWGIGKLDMDHLKSHPCITLKIPEGVWKLSSCQDKKGFICKMEADIH
IAKEQPGKGPSHGTVPLAVALTLIILLASLILAFCIYKRNGGSFRRLTGLGHPYYPTINF
STVHLEENILISDFEKNSC
Download sequence
Identical sequences ENSDORP00000011707 ENSDORP00000011707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]