SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011790 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011790
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 2.67e-83
Family Integrin A (or I) domain 0.000000371
Further Details:      
 
Domain Number 2 Region: 336-452
Classification Level Classification E-value
Superfamily Integrin domains 3.09e-17
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 621-698
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.03e-16
Family Integrin beta tail domain 0.002
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000035
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 6 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family Integrin beta EGF-like domains 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011790
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family Integrin beta EGF-like domains 0.034
Further Details:      
 
Domain Number - Region: 500-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011790   Gene: ENSDORG00000012531   Transcript: ENSDORT00000012538
Sequence length 769
Comment pep:novel scaffold:dipOrd1:scaffold_8838:8661:30842:-1 gene:ENSDORG00000012531 transcript:ENSDORT00000012538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSCRLLLLLLVGQLLLGSALSQECTKYKVNSCQDCIQLGPGCAWCQKLNFTDQGEPDST
RCDTREQLQKKGCEADNILDPRSFAMPQKDPQRGSTQLSPQHVTLHLRPGQEAAFNVTFR
RAEGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITKSGRVGFGSFVDKTVLPFV
NTHPEKLKNPCPNKEKGCQAPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVYATDDGFHFAGDGKLGAILTPNDGRCHLENNMYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTKRMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAY
NKLSSRVFLDHSPLPDTLRVTYDSFCSNGASHMGQPRGDCDGVQINVPITFQVKVTATAC
LQQQSFVIRALGFTDTVTVRVLPQCQCQCRDQKQDRGLCGGKGSLECGVCRCDAGYIGKN
CECQTQGKSSQELEGSCRKDNSSLVCSGMGDCVCGQCMCHASDEPNKEIFGRYCECDNVN
CERHQGQPCGGPXXXXCFCGQCQCKPGFEGSACQCSRSTARCLNPRGVECSGRGRCQCNT
CKCDPGYQPPLCEDCPGCPAPCSNYTSCVECLKFAKGPYEKNCSAACVNVRLQNATRKGK
TCKERDSDNCWISYTMQQRDGRDSYDIYVEDSRECVEGPQIGAIVGGTVAGIVLIGVLLL
VIWKALTHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAEG
Download sequence
Identical sequences ENSDORP00000011790 ENSDORP00000011790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]