SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011813 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011813
Domain Number 1 Region: 3004-3262
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-56
Family YWTD domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 1246-1511
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 1868-2127
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 1561-1817
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-43
Family YWTD domain 0.0000234
Further Details:      
 
Domain Number 5 Region: 513-746
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-40
Family YWTD domain 0.0000101
Further Details:      
 
Domain Number 6 Region: 177-446
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 7 Region: 3846-4118
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-37
Family YWTD domain 0.00000886
Further Details:      
 
Domain Number 8 Region: 2228-2445
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-34
Family YWTD domain 0.0000401
Further Details:      
 
Domain Number 9 Region: 2892-2996,3255-3316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.82e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1157-1238,1525-1556
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 11 Region: 825-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0000883
Further Details:      
 
Domain Number 12 Region: 3541-3581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 13 Region: 906-945
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 14 Region: 3625-3670
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 15 Region: 3584-3619
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 16 Region: 3462-3502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 17 Region: 3344-3384
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 990-1027
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 19 Region: 866-908
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 20 Region: 2668-2705
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 951-988
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 22 Region: 2535-2575
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 23 Region: 3-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 24 Region: 1034-1074
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 25 Region: 2708-2742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 3426-3461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 27 Region: 2790-2826
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 28 Region: 2575-2614
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 2828-2867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 30 Region: 3386-3424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 2748-2782
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 32 Region: 82-167,454-496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 33 Region: 3307-3342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 3713-3748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 35 Region: 2499-2536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 1822-1872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000178
Family EGF-type module 0.012
Further Details:      
 
Domain Number 37 Region: 48-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 38 Region: 1120-1155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 779-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000508
Family EGF-type module 0.039
Further Details:      
 
Domain Number 40 Region: 1083-1117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 2634-2664
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000124
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 42 Region: 3667-3703
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 43 Region: 3757-3805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.052
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000011813
Domain Number - Region: 4171-4205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 3796-3832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 4207-4244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000447
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 3507-3539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000484
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 4243-4278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 2454-2513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4126-4159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011813   Gene: ENSDORG00000012553   Transcript: ENSDORT00000012563
Sequence length 4517
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5008:59135:148990:1 gene:ENSDORG00000012553 transcript:ENSDORT00000012563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKTQRCQPNEHNCLGTE
LCVPMSRLCNGVQDCMDGSDEGAHCRELRSNCSRLGCQHHCVPTPSGPTCYCNSSFQLQA
DGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGYLLQPDNRSCKAKNEPVDRPPVLLI
ANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPG
LKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDIDDRIFVCNRNGDTCVTLLDLELY
NPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTKLVDSKIVFPHGITLDLVSRLVYW
ADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFENYLYATNSDNANAQQKTSVIRVN
RFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACENDQYGKPGGCSNICLLANNHEVKT
CLCRSGFNLGSDGKSCKKPEHELFLVYGKGRPGIIRGMDMGAKVPDEHMIPIENLMNPRA
LDFHAESGFIYFADTTSYLIGRQKIDGTERETILKDGIHNVEGVAVDWMGDNLYWTDDGP
KKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNGWMYWTDWEEDPKDSRRGRLERAW
MDGSHRDVFVTSKTVLWPNGLSLDIPAGRLYWVDAFYDRIETILLNGTDRKIVYEGPELN
HAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVTLLRSERPPVFEIRMYDAQQQQVG
TNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDTDGVTCLANPSYVPPPQCQPGEFACAN
SRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNS
EDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFT
CSNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDY
SDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGVTHV
CDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCANNTSVCLPPD
KLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAPGEGIVCSCPLGMELGPDNHTCQI
QSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGESCRSLDPFKPFIIFSNRHEIRRID
LHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDKIYRGKLLDNGALTSFEVVIQYGL
ATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTTLLAGDIEHPRAIALDPRDGILFW
TDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLTVDYLEKRILWIDARSDAIYSARY
DGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPF
DLQVYHPSRQPMAPNPCKANGGRGPCSHLCLINYNRTVSCACPHLMKLHKDNTTCYEFKK
LLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFI
NGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQP
HGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSGQKGPVGLAIDFPESKLYWISSGNH
TINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGSVVLR
NSTTLVMHMKVYDESIQLDHEGTNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQ
ACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSGTSLAVGIDFHAENDTIYWVDMGLS
TISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVIS
QGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYQDG
KLYWCDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGS
KDNATDSVPLRTGIGVQLKDIKVFNRDRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNAPVQPFEDPEHMKNVIALAFDYRA
GTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIVENVGSVEGLAYHRGWDTLYWTSYTTS
TITRHTVDQTRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSG
ANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPFGL
AVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQPMGIIAVANDTNSCELSPCRVN
NGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRAVNSSCRAQDEFECANGECISFSLTCD
GVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCVSNMLWCNGIDDCGDGSDEIPCNKTAC
AVGEFRCRGGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSL
CYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGE
DESHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCGPSSFPCPGTH
VCVPERWLCDGDKDCADGADESVAAGCLYNSTCDDREFMCQNRQCIPKHFVCDHDRDCAD
GSDESPECEYPTCGPNEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSPEHKCN
ASSQFLCSSGRCVAEVLLCNGQDDCGDGSDERGCHVNECLSRKLSGCSQDCEDLKIGFKC
RCRPGFRLKDDGRTCADVDECSTTFPCSQLCINTHGSYKCLCVEGYAPRGGDPHSCKAVT
DEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRR
MHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLR
EPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSVIVDTKITWPNGLTLDYVTERIYW
ADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGANK
TLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGG
DGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGI
CTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDE
RDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSG
RCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDDCGDSDE
SCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCSPRCDMDQFQCKSGHCIPL
RWRCDADADCMDGSDEEACGTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPE
ECARFVCPPNRPFRCKNDRVCLWIGRQCDGMDNCGDGTDEEDCEPSTAQTAHCKDKKEFL
CRNQRCLSSSLRCNMFDDCGDGSDEEDCRIDPKLTSCTTNASICGDEARCVRTEKAAYCA
CRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQ
VLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISYRS
XXXXXXXXXXXXXXXXXXXXXXXXXXISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQM
KGENRKTLISGMIDEPHAIXXXXXXXTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWP
TGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTY
INNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGP
VCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCTLQCFNGGSCFLNARRQPKCRCQPRYT
GDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGYCANNSTCTVNQG
NQPQCRCLPGFLGDRCQYRQCSGFCENLGTCQMAADGSRQCRCTVYFEGPRCEVNKCSRC
LQGACVVNRQSGDVTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXMASILIPLLLLLLLLLVAGVVYWYKRRVRGAKGFQHQRMTNGAMNVE
IGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEK
RELLGRGPEDEIGDPLA
Download sequence
Identical sequences ENSDORP00000011813 ENSDORP00000011813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]