SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011914 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011914
Domain Number 1 Region: 96-302
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-71
Family ALDH-like 0.0000000806
Further Details:      
 
Domain Number 2 Region: 395-504
Classification Level Classification E-value
Superfamily ALDH-like 4.06e-16
Family ALDH-like 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011914   Gene: ENSDORG00000012670   Transcript: ENSDORT00000012670
Sequence length 509
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3507:6551:25470:-1 gene:ENSDORG00000012670 transcript:ENSDORT00000012670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPAPRLLRTLLASAMSTGSFVVSQPLNYRGGARVEPADSSGTEKAFEPATXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERTNEIANVETINNGKSIFE
ARLDIENCWQTLEYFAGLAGSMAGEHIQLQGGSFGYTRREPLGVCVGIGAWNYPFQIACW
KSAPALACGNAMVFKPSPFTPVSVLLLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHRDV
AKVSFTGSVPTGVKIMEMSAKGIKHVTLELGGKSPLIIFSDCNMENAVKGALMANFLTQG
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCRDDMTCVQEEIFGPVMSILSFDSE
EEVLERANNTTFGLAAGVFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF
GRENGRATIEYYSQLKTVCVEMGDVESAF
Download sequence
Identical sequences ENSDORP00000011914 ENSDORP00000011914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]