SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011928 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011928
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.46e-24
Family 4'-Phosphopantetheinyl transferase SFP 0.0064
Further Details:      
 
Domain Number 2 Region: 125-248
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.96e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011928   Gene: ENSDORG00000012684   Transcript: ENSDORT00000012684
Sequence length 261
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5856:29424:52362:1 gene:ENSDORG00000012684 transcript:ENSDORT00000012684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRLCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAA
MAGRLMIRKLIAEKLHIPWNHIRLQRTAKGKPILAKDSLNPYPNFNFNISHQGDYAVLAA
EPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFNDEWTQLDMFYRNWALK
ESFIKAIGVGLGFELQRLEFDIAPLNLDIGQVYKETRLFLDGEEEKEWSFEESKIDDHHF
VAVALRKPDGSRYQEQNGSKL
Download sequence
Identical sequences ENSDORP00000011928 ENSDORP00000011928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]