SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012000 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012000
Domain Number 1 Region: 228-473
Classification Level Classification E-value
Superfamily ALDH-like 1.23e-86
Family ALDH-like 0.00000000105
Further Details:      
 
Domain Number 2 Region: 2-190
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-63
Family ALDH-like 0.00000000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012000   Gene: ENSDORG00000012759   Transcript: ENSDORT00000012759
Sequence length 478
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1721:468:14856:1 gene:ENSDORG00000012759 transcript:ENSDORT00000012759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHDAVSKKTFPTVNPSTGEAICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDA
SDRGRLLYRLADLIERDRTYLAALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHG
KTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTA
LYVANLIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGHLIQTASGSSN
LKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVER
SVARAKSRVVGNPDSXXXXXXXVDETQFHKILGYIKSGKQEGAKLLCGGGAAADRGYFIQ
PTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVARANNSKYGLAAAVFTKDLDKASYL
SQALQAGTVWINCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEIKTVTIKVPQKNS
Download sequence
Identical sequences ENSDORP00000012000 ENSDORP00000012000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]