SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012178 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012178
Domain Number 1 Region: 418-675
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-48
Family YWTD domain 0.000000106
Further Details:      
 
Domain Number 2 Region: 206-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000262
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 4-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000484
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 4 Region: 244-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 5 Region: 125-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000127
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 159-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 79-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 9 Region: 371-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 10 Region: 335-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 290-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012178   Gene: ENSDORG00000012954   Transcript: ENSDORT00000012954
Sequence length 844
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3319:47561:65348:1 gene:ENSDORG00000012954 transcript:ENSDORT00000012954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAKCDPSQFQCTNGRCITLLWKCDGDEDCTDGSDERNCVKKTCAESDFVCNNGQCVPNR
WQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDSGEDEEN
CGNITCNPLEFTCSSGRCISKNFVCNGQDDCNDGSDEFDCAPPTCGAHEFQCSTSSCIPI
SWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGS
DEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRS
GECIDILKVCNQEQDCRDWSDEPLKECXXXTSMECSINNGGCSHICKDLVIDYECDCAAG
FELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIF
TNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRH
VKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKYLFNSDLREPASIAVDP
LSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTLDIQWPNGITLDLIKSRLYWLDSKLHMLS
SVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNL
NDAQDIIVYHELVQPSGKNCEDDENGGCEYLCLPAPQIDHSPXXXXXXXXXXXXXXXXXX
XXXXXXXXXYGETKDNTTEIPATSGLVPGGINVTTAVSEVSVPPKGSSAAWAILPLLLLV
MAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVSTD
DDLA
Download sequence
Identical sequences ENSDORP00000012178 ENSDORP00000012178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]