SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012198 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012198
Domain Number 1 Region: 259-637,670-746
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.14e-175
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000423
Further Details:      
 
Domain Number 2 Region: 6-210
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.41e-30
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012198   Gene: ENSDORG00000012972   Transcript: ENSDORT00000012976
Sequence length 787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5045:96310:137895:1 gene:ENSDORG00000012972 transcript:ENSDORT00000012976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSSMVAKST
LDIVLANKDXXXXXXXXXXXXXXXXXXXXTLERSYLLKINGKXXXXXXXXXXXXXXXXXX
XXXDAAETYNLSEKWTHASTLFNAGTNRPQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWH
LDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGE
EFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMVYKDSCNRKSNQQNLGTIKC
SNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINY
YPIPEASLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEASCD
LAKEYGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLLAPMPTA
STAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGS
IQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHF
YGWKQGLKTGMYYLRTRPAANPIQFTINKEKLRDKEKTLKEEEEKERNTAAMVCSLENRD
ECLMCGS
Download sequence
Identical sequences ENSDORP00000012198 ENSDORP00000012198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]