SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012244 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012244
Domain Number 1 Region: 306-477,511-675
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.9e-67
Family YicI catalytic domain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 60-304
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.17e-39
Family YicI N-terminal domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 678-774
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.83e-16
Family Putative glucosidase YicI, domain 3 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012244   Gene: ENSDORG00000013023   Transcript: ENSDORT00000013024
Sequence length 907
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3438:3:10134:1 gene:ENSDORG00000013023 transcript:ENSDORT00000013024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPFGRLEVTPGAQQHGAGGPGHQHTQQRPGQPGAAPTQCDVSPNNRFDCAPDRAITQNEC
EARGCCYAPTQPGPREPLRGQPWCFFPPSYPSYRLKGLKPSETGYTAALVRGTPAFLPKD
ILVLQLDVLMETDTRLRLTIKDPSSKRYEVPLETPHVHSRAPSPLYSVEFWEEPFGVVVR
RKSDGWVLLNTTVAPLIFADQFLHLSTSLASRYVTGLGERLSPLMLSTDWSRVTLWNRDL
APTPGANLYGSHPFYMVLEDGGSAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDLYVFL
GPEPKSVVQQYLDVVGFPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTQARFLLDVQWN
DLDYMDARRDFFNKEGFADFPDTVRELHQGGRRYVMIVDPAISSGSPAGSYRPYDEGLRR
GVFVTNATGQPLIGKVWAWSTAFPDFTNPGTLNWWRNMVAEFHAVPFDGMWIDMNEPSNF
VRGSEHGCPDNTLENPPYVPGVVGGTLQAATICASSLQFLSTHYNLHNLYGLTEAIASSR
ALEKVRGTRSFVISRSTFSGHGHYAGHWTGDVWSSWEQLAYSVPEILQFSLLGVPLVGAD
ICGFLGNTSEEXXXXXXXXXXXXXXMRNHNDLLSQPQEPYRFSPPAQQAMRKALALRYAL
LPHLYTLFHRAHVRGDTVARPLFLEFPTDSGTWLVDRQLLWGEALLITPVLDPGKDEVTG
YFPSGTWYDLQTVPIDTFGSLPLPLSTRGRTAIHSRGQWVTLPAPLDTINVHLRAGYIVP
LQGTALTTTESRKQPMALAVALAAGGEARGELFWDDGESLGVLEAGAYTEVTFSAKNNTV
VSRPVHVSREGADLQLSRVVVLGVSAAPQQVLSDGIPVSNFTYNPSSQLLAIPVSLSMGQ
QFCISWA
Download sequence
Identical sequences ENSDORP00000012244 ENSDORP00000012244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]