SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012248 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012248
Domain Number 1 Region: 39-144
Classification Level Classification E-value
Superfamily FKBP-like 1.55e-16
Family FKBP immunophilin/proline isomerase 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012248   Gene: ENSDORG00000013029   Transcript: ENSDORT00000013028
Sequence length 145
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1179:50403:73369:-1 gene:ENSDORG00000013029 transcript:ENSDORT00000013028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRRRAEGGGRLAESPPGRCRSARSPVSPPARPPAAAMGVQVETISPGDGRTFPKRGQTC
VVHYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSVGQRAKLTISPDYAY
GATGHPGIIPPNATLVFDVELLRLE
Download sequence
Identical sequences ENSDORP00000012248 ENSDORP00000012248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]