SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012275 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012275
Domain Number 1 Region: 27-209
Classification Level Classification E-value
Superfamily TIMP-like 9.81e-80
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012275   Gene: ENSDORG00000013061   Transcript: ENSDORT00000013059
Sequence length 220
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_218:3529:25671:-1 gene:ENSDORG00000013061 transcript:ENSDORT00000013059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAARSLRLALGLLLLAAPLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KNINGLQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Download sequence
Identical sequences ENSDORP00000012275 ENSDORP00000012275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]