SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012523 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012523
Domain Number 1 Region: 30-138
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.29e-23
Family Peptidyl-tRNA hydrolase-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012523   Gene: ENSDORG00000013321   Transcript: ENSDORT00000013321
Sequence length 139
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5495:56721:57691:-1 gene:ENSDORG00000013321 transcript:ENSDORT00000013321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSGLLRAELWLSRAMSRRVLEPGWPTKRWLVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVADSWTRDRRCVADLALAPLGDDAQLVLLRPRRLMNANGRSVAQAAKLFGLTAEEVYLV
HDELDKPLGKLALKLGGSA
Download sequence
Identical sequences ENSDORP00000012523 ENSDORP00000012523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]