SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012542 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012542
Domain Number 1 Region: 31-132,164-181
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-29
Family FKBP immunophilin/proline isomerase 0.00045
Further Details:      
 
Domain Number 2 Region: 147-248
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000786
Family Calbindin D9K 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012542   Gene: ENSDORG00000013340   Transcript: ENSDORT00000013340
Sequence length 255
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5770:41610:49721:-1 gene:ENSDORG00000013340 transcript:ENSDORT00000013340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSTMHFLSTLAFFFYLWGLCTAQGQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHY
DGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMDMCPGEKRKVIIPPSFAYG
KEGYGILEELFPLQNVLASCYPLLHVLKCMFLVTNDCAEGKIPPDATLIFEIELYAVTKG
PRSIETFKQIDTDNDRQLSKTEIDHYLKKEFEKDEKPRDKTYQNAVLEDIFKRNDHDKDG
FISPKEYNVYHHDEL
Download sequence
Identical sequences ENSDORP00000012542 ENSDORP00000012542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]