SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012611 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000012611
Domain Number - Region: 122-162
Classification Level Classification E-value
Superfamily UBA-like 0.00204
Family CUE domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012611   Gene: ENSDORG00000013412   Transcript: ENSDORT00000013412
Sequence length 260
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1551:96678:98030:-1 gene:ENSDORG00000013412 transcript:ENSDORT00000013412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDEVIFSYVLGVLEDLGPLGPSEENFDMEAFTEMMEAYVPGFAHIPKGTIGDMMQKLSV
QLSDARNKENLYPQSSYVQSQVSISPEPLQQPEECNEDTRSPAAAGDTQNEAAGNEEELL
PGVDVLLEVFPTCSMQQAQWVLAKARGDLEEAVQILVEGKEGPPGWDGPNQDLPRRLRGP
QKDELKSFILQKYMMVDSAEDQKIHRPMVPKEAPKKLIRYIDNQVVSTKGERFKDVRNPE
AEEMKATYINLKPARKYRFH
Download sequence
Identical sequences ENSDORP00000012611 ENSDORP00000012611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]