SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012948 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012948
Domain Number 1 Region: 309-347
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000785
Family VPS23 C-terminal domain 0.0083
Further Details:      
 
Domain Number 2 Region: 1-52
Classification Level Classification E-value
Superfamily UBC-like 0.0000014
Family UEV domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000012948
Domain Number - Region: 222-299
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0022
Family FCH domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012948   Gene: ENSDORG00000013773   Transcript: ENSDORT00000013773
Sequence length 347
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_596:4663:28743:-1 gene:ENSDORG00000013773 transcript:ENSDORT00000013773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKYRDLTVRETVNVITLYKDLKPVLESYVFNDGSSRELMNLTGTIPVPYRXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSYMPSMPSGISAYPSGYPPNPSGYPGCPYPPGG
SYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELN
ALKRTKEDLKKGHQKLEEMVNRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDI
DEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLK
Download sequence
Identical sequences ENSDORP00000012948 ENSDORP00000012948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]